| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [277358] (1 PDB entry) |
| Domain d4y6ie_: 4y6i E: [277365] automated match to d2zomc_ mutant |
PDB Entry: 4y6i (more details), 1.7 Å
SCOPe Domain Sequences for d4y6ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y6ie_ d.58.5.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
tasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyvvqmilkt
tvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr
Timeline for d4y6ie_: