SCOPe 2.05: Domain d4y7eb_: 4y7e B:

Lineage for d4y7eb_ (4y7e B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (21 species)
   not a true protein

7. Species Streptomyces thermolilacinus [TaxId:285540] [272999] (2 PDB entries)

8. Domain d4y7eb_: 4y7e B: [277363]
   automated match to d1bqca_
   complexed with bma, ca, gol

Details for d4y7eb_

PDB Entry: 4y7e, 1.5 Å

PDB Description: crystal structure of beta-mannanase from streptomyces thermolilacinus with mannohexaose

PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d4y7eb_:

Sequence; same for both SEQRES and ATOM records:

>d4y7eb_ c.1.8.3 (B:) automated matches {Streptomyces thermolilacinus [TaxId: 285540]}
tglhvqggrllegngndfvmrgvnhahtwypgqtrsladikalgantvrvvlsdghrwtr
ngpadvaavidrckanrlicvlevhdttgygeepaagtldhaadywislmdvlagqedyv
ivnignepwgntdpagwtaptiaavkklraaglahtlmidapnwgqdwqgvmradarsvy
eadptgnllfsihmysvfdtaaeiddyleafvdaglplvigafggppdqwgdpdedtmla
aaerlrlgylawswsgntdpvldlaigfdpdrlsgwgqrvfhgvhgigetsreatvfg

Timeline for d4y7eb_:

• d4y7eb_ is new in SCOPe 2.05-stable
  
• d4y7eb_ appears in SCOPe 2.06
  
• d4y7eb_ appears in the current release, SCOPe 2.08