SCOPe 2.06: Domain d4y6id_: 4y6i D:

Lineage for d4y6id_ (4y6i D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277358] (1 PDB entry)

8. Domain d4y6id_: 4y6i D: [277360]
   automated match to d2zomc_
   mutant

Details for d4y6id_

PDB Entry: 4y6i, 1.7 Å

PDB Description: crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation

PDB Compounds: (D:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4y6id_:

Sequence; same for both SEQRES and ATOM records:

>d4y6id_ d.58.5.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
tasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyvvqmilkt
tvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr

Timeline for d4y6id_:

• d4y6id_ first appeared in SCOPe 2.05
  
• d4y6id_ appears in SCOPe 2.07
  
• d4y6id_ appears in the current release, SCOPe 2.08