Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [277358] (1 PDB entry) |
Domain d4y6id_: 4y6i D: [277360] automated match to d2zomc_ mutant |
PDB Entry: 4y6i (more details), 1.7 Å
SCOPe Domain Sequences for d4y6id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y6id_ d.58.5.0 (D:) automated matches {Escherichia coli [TaxId: 83333]} tasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyvvqmilkt tvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr
Timeline for d4y6id_: