Lineage for d4y6id_ (4y6i D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950974Species Escherichia coli [TaxId:83333] [277358] (1 PDB entry)
  8. 2950978Domain d4y6id_: 4y6i D: [277360]
    automated match to d2zomc_
    mutant

Details for d4y6id_

PDB Entry: 4y6i (more details), 1.7 Å

PDB Description: crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation
PDB Compounds: (D:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4y6id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y6id_ d.58.5.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
tasvvvlatapdeataqdlaakvlaeklaaaatlipgatslyywegkleqeyvvqmilkt
tvshqqallealkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d4y6id_:

Click to download the PDB-style file with coordinates for d4y6id_.
(The format of our PDB-style files is described here.)

Timeline for d4y6id_: