SCOP 1.71: Domain d1cxla3: 1cxl A:407-496

Lineage for d1cxla3 (1cxl A:407-496)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1cxla3: 1cxl A:407-496 [27736]
   Other proteins in same PDB: d1cxla1, d1cxla2, d1cxla4
   complexed with ca, g4d, glc, glf, mpd; mutant

Details for d1cxla3

PDB Entry: 1cxl, 1.81 Å

PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q

SCOP Domain Sequences for d1cxla3:

Sequence; same for both SEQRES and ATOM records:

>d1cxla3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat

Timeline for d1cxla3:

• d1cxla3 first appeared (with stable ids) in SCOP 1.55
  
• d1cxla3 appears in SCOP 1.69
  
• d1cxla3 appears in SCOP 1.73
  
• d1cxla3 appears in the current release, SCOPe 2.08