SCOPe 2.08: Domain d4xqda_: 4xqd A:

Lineage for d4xqda_ (4xqd A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Hypocrea jecorina [TaxId:51453] [277348] (4 PDB entries)

8. Domain d4xqda_: 4xqd A: [277352]
   automated match to d2jica_
   complexed with iod, trs

Details for d4xqda_

PDB Entry: 4xqd, 1.5 Å

PDB Description: x-ray structure analysis of xylanase-wt at ph4.0

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4xqda_:

Sequence; same for both SEQRES and ATOM records:

>d4xqda_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
iqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvinf
sgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtqr
vnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfss
gsasitvs

Timeline for d4xqda_:

• d4xqda_ first appeared in SCOPe 2.05
  
• d4xqda_ appears in SCOPe 2.07