Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Trichoderma reesei [TaxId:51453] [235862] (5 PDB entries) |
Domain d4xqwa_: 4xqw A: [277347] automated match to d4hkla_ complexed with iod, mes |
PDB Entry: 4xqw (more details), 1.5 Å
SCOPe Domain Sequences for d4xqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xqwa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 51453]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs sgsasitvs
Timeline for d4xqwa_: