Lineage for d4xqwa_ (4xqw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051454Species Trichoderma reesei [TaxId:51453] [235862] (5 PDB entries)
  8. 2051459Domain d4xqwa_: 4xqw A: [277347]
    automated match to d4hkla_
    complexed with iod, mes

Details for d4xqwa_

PDB Entry: 4xqw (more details), 1.5 Å

PDB Description: x-ray structure analysis of xylanase-n44e with mes at ph6.0
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4xqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xqwa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d4xqwa_:

Click to download the PDB-style file with coordinates for d4xqwa_.
(The format of our PDB-style files is described here.)

Timeline for d4xqwa_: