Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.2: Acetokinase-like [53080] (4 proteins) |
Protein automated matches [277339] (1 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [277340] (3 PDB entries) |
Domain d4xh5a2: 4xh5 A:193-397 [277346] automated match to d2e1za2 complexed with anp, gol, ppi, so4; mutant |
PDB Entry: 4xh5 (more details), 2.11 Å
SCOPe Domain Sequences for d4xh5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xh5a2 c.55.1.2 (A:193-397) automated matches {Salmonella typhimurium [TaxId: 99287]} dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv icaviptneekmialdaihlgnvka
Timeline for d4xh5a2: