Lineage for d4wvwa_ (4wvw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390396Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2390410Domain d4wvwa_: 4wvw A: [277334]
    automated match to d4bmea_
    complexed with peg, slt

Details for d4wvwa_

PDB Entry: 4wvw (more details), 1.47 Å

PDB Description: chicken galectin-8 n-terminal domain complexed with 3'-sialyl-lactose
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d4wvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wvwa_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kkisnpiipyvgtilgglvpgelivlhgsipddadrfqvdlqcgssikpradvafhfnpr
fkwsgcvvcntlerekwgweeityempfqkgrpfeivimilkdkfqvsvnkkhlllynhr
isleridtlgiygkvqiksiefvs

SCOPe Domain Coordinates for d4wvwa_:

Click to download the PDB-style file with coordinates for d4wvwa_.
(The format of our PDB-style files is described here.)

Timeline for d4wvwa_: