Lineage for d4wvva_ (4wvv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780743Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2780747Domain d4wvva_: 4wvv A: [277331]
    automated match to d4bmea_

Details for d4wvva_

PDB Entry: 4wvv (more details), 1.21 Å

PDB Description: chicken galectin-8 n-terminal domain complexed with lactose
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d4wvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wvva_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kkisnpiipyvgtilgglvpgelivlhgsipddadrfqvdlqcgssikpradvafhfnpr
fkwsgcvvcntlerekwgweeityempfqkgrpfeivimilkdkfqvsvnkkhlllynhr
isleridtlgiygkvqiksiefvsn

SCOPe Domain Coordinates for d4wvva_:

Click to download the PDB-style file with coordinates for d4wvva_.
(The format of our PDB-style files is described here.)

Timeline for d4wvva_: