SCOPe 2.08: Domain d7cgta3: 7cgt A:407-495

Lineage for d7cgta3 (7cgt A:407-495)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d7cgta3: 7cgt A:407-495 [27733]
   Other proteins in same PDB: d7cgta1, d7cgta2, d7cgta4
   complexed with ca; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d7cgta3

PDB Entry: 7cgt, 3 Å

PDB Description: rameb complex of cyclodextrin glycosyltransferase mutant

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d7cgta3:

Sequence; same for both SEQRES and ATOM records:

>d7cgta3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqyttae

Timeline for d7cgta3:

• d7cgta3 first appeared (with stable ids) in SCOP 1.55, called d7cgt_3
  
• d7cgta3 appears in SCOPe 2.07