Lineage for d4wdfa_ (4wdf A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563291Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2563292Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2563306Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2563311Protein automated matches [190813] (2 species)
    not a true protein
  7. 2563314Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries)
  8. 2563337Domain d4wdfa_: 4wdf A: [277325]
    automated match to d2xmia_
    complexed with a2p; mutant

Details for d4wdfa_

PDB Entry: 4wdf (more details), 2 Å

PDB Description: catalytic domain of mouse 2',3'-cyclic nucleotide 3'- phosphodiesterase, with mutation v321a, complexed with 2',5'-adp
PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d4wdfa_:

Sequence, based on SEQRES records: (download)

>d4wdfa_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyfg
krppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvlt
dqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpaqtgldlldilqqvkggsqgea
vgelprgklyslgkgrwmlsltkkmevkaiftgyyg

Sequence, based on observed residues (ATOM records): (download)

>d4wdfa_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdeklelvsyfgkrp
pgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltdqe
lqlwpsdldkpsaseglppgsrahvtlgcaadvqpaqtgldlldilqqvkggsqgeavge
lprgklyslgkgrwmlsltkkmevkaiftgyyg

SCOPe Domain Coordinates for d4wdfa_:

Click to download the PDB-style file with coordinates for d4wdfa_.
(The format of our PDB-style files is described here.)

Timeline for d4wdfa_: