SCOPe 2.05: Domain d4wdga_: 4wdg A:

Lineage for d4wdga_ (4wdg A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
   automatically mapped to Pfam PF05881

6. Protein automated matches [190813] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries)

8. Domain d4wdga_: 4wdg A: [277319]
   automated match to d2xmia_
   complexed with a2p; mutant

Details for d4wdga_

PDB Entry: 4wdg, 2.05 Å

PDB Description: catalytic domain of mouse 2',3'-cyclic nucleotide 3'- phosphodiesterase, with mutation v321a, complexed with 2',5'-adp

PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d4wdga_:

Sequence, based on SEQRES records:

>d4wdga_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyf
gkrppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvl
tdqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpaqtgldlldilqqvkggsqge
avgelprgklyslgkgrwmlsltkkmevkaiftgyyg

Sequence, based on observed residues (ATOM records):

>d4wdga_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdeklelvsyfgkr
ppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltdq
elqlwpsdldkpsaseglppgsrahvtlgcaadvqpaqtgldlldilqqvkggsqgeavg
elprgklyslgkgrwmlsltkkmevkaiftgyyg

Timeline for d4wdga_:

• d4wdga_ is new in SCOPe 2.05-stable
  
• d4wdga_ appears in SCOPe 2.06
  
• d4wdga_ appears in the current release, SCOPe 2.08