SCOPe 2.03: Domain d1cgya3: 1cgy A:407-495

Lineage for d1cgya3 (1cgy A:407-495)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1cgya3: 1cgy A:407-495 [27730]
   Other proteins in same PDB: d1cgya1, d1cgya2, d1cgya4
   complexed with ca, mal; mutant

Details for d1cgya3

PDB Entry: 1cgy, 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1cgya3:

Sequence; same for both SEQRES and ATOM records:

>d1cgya3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1cgya3:

• d1cgya3 first appeared (with stable ids) in SCOP 1.55, called d1cgy_3
  
• d1cgya3 appears in SCOPe 2.02
  
• d1cgya3 appears in SCOPe 2.04
  
• d1cgya3 appears in the current release, SCOPe 2.08