Lineage for d1cgw_3 (1cgw 407-495)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins) 
Protein Cyclodextrin glycosyltransferase [51018] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries) 
Domain d1cgw_3: 1cgw 407-495 [27729]
Other proteins in same PDB: d1cgw_1, d1cgw_2, d1cgw_4
Details for d1cgw_3
PDB Entry: 1cgw (more details), 2.53 Å
PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
SCOP Domain Sequences for d1cgw_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgw_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa
SCOP Domain Coordinates for d1cgw_3:
Click to download the PDB-style file with coordinates for d1cgw_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cgw_3:
- d1cgw_3 first appeared (with stable ids) in SCOP 1.55
- d1cgw_3 appears in SCOP 1.59
- d1cgw_3 appears in SCOP 1.63
- d1cgw_3 appears in the current release, SCOPe 2.08, called d1cgwa3
View in 3D
