Lineage for d4raea_ (4rae A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897573Species Mycobacterium tuberculosis [TaxId:83332] [187938] (15 PDB entries)
  8. 2897606Domain d4raea_: 4rae A: [277284]
    automated match to d3cq5a_

Details for d4raea_

PDB Entry: 4rae (more details), 2.59 Å

PDB Description: crystal structure of rv1600 encoded aminotransferase from mycobacterium tuberculosis
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d4raea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4raea_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidlh
rypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfvp
sysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvslp
dlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyli
atpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgfr
vipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasari
atdlvpv

SCOPe Domain Coordinates for d4raea_:

Click to download the PDB-style file with coordinates for d4raea_.
(The format of our PDB-style files is described here.)

Timeline for d4raea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4raeb_