Lineage for d4oyyk_ (4oyy K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902172Species Fungus (Humicola insolens) [TaxId:34413] [257354] (2 PDB entries)
  8. 2902186Domain d4oyyk_: 4oyy K: [277278]
    automated match to d4oyyb_

Details for d4oyyk_

PDB Entry: 4oyy (more details), 3 Å

PDB Description: humicola insolens cutinase
PDB Compounds: (K:) cutinase

SCOPe Domain Sequences for d4oyyk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oyyk_ c.69.1.0 (K:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
gaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvggpy
daalatnflprgtsqanidegkrlfalanqkcpntpvvaggysqgaaliaaavselsgav
keqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpahlsytiearg
eaarflrdrir

SCOPe Domain Coordinates for d4oyyk_:

Click to download the PDB-style file with coordinates for d4oyyk_.
(The format of our PDB-style files is described here.)

Timeline for d4oyyk_: