Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Fungus (Humicola insolens) [TaxId:34413] [257354] (2 PDB entries) |
Domain d4oyyf_: 4oyy F: [277276] automated match to d4oyyb_ |
PDB Entry: 4oyy (more details), 3 Å
SCOPe Domain Sequences for d4oyyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oyyf_ c.69.1.0 (F:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]} qlgaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvgg pydaalatnflprgtsqanidegkrlfalanqkcpntpvvaggysqgaaliaaavselsg avkeqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpahlsytiea rgeaarflrdrir
Timeline for d4oyyf_: