Lineage for d5dcxh_ (5dcx H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963212Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2963224Protein automated matches [277252] (2 species)
    not a true protein
  7. 2963229Species Adeno-associated virus 2 [TaxId:10804] [277253] (1 PDB entry)
  8. 2963237Domain d5dcxh_: 5dcx H: [277261]
    Other proteins in same PDB: d5dcxa2, d5dcxb2
    automated match to d1uuta_
    complexed with mg

Details for d5dcxh_

PDB Entry: 5dcx (more details), 2.6 Å

PDB Description: structural studies of aav2 rep68 reveal a partially structured linker and compact domain conformation
PDB Compounds: (H:) Protein Rep68

SCOPe Domain Sequences for d5dcxh_:

Sequence, based on SEQRES records: (download)

>d5dcxh_ d.89.1.3 (H:) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaqhlthvsqtqeqnkenq

Sequence, based on observed residues (ATOM records): (download)

>d5dcxh_ d.89.1.3 (H:) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrgnkvvdesyipnyllpktqpelqwawtnmeqylsaclnlter
krlvaqhlthvsqtqeqnkenq

SCOPe Domain Coordinates for d5dcxh_:

Click to download the PDB-style file with coordinates for d5dcxh_.
(The format of our PDB-style files is described here.)

Timeline for d5dcxh_: