Lineage for d5dcxf_ (5dcx F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569784Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2569785Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2569832Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2569844Protein automated matches [277252] (2 species)
    not a true protein
  7. 2569849Species Adeno-associated virus 2 [TaxId:10804] [277253] (1 PDB entry)
  8. 2569855Domain d5dcxf_: 5dcx F: [277258]
    Other proteins in same PDB: d5dcxa2, d5dcxb2
    automated match to d1uuta_
    complexed with mg

Details for d5dcxf_

PDB Entry: 5dcx (more details), 2.6 Å

PDB Description: structural studies of aav2 rep68 reveal a partially structured linker and compact domain conformation
PDB Compounds: (F:) Protein Rep68

SCOPe Domain Sequences for d5dcxf_:

Sequence, based on SEQRES records: (download)

>d5dcxf_ d.89.1.3 (F:) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaqhl

Sequence, based on observed residues (ATOM records): (download)

>d5dcxf_ d.89.1.3 (F:) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktggnkvvdesyipnyllpktqpelqwawtnmeqylsaclnlter
krlvaqhl

SCOPe Domain Coordinates for d5dcxf_:

Click to download the PDB-style file with coordinates for d5dcxf_.
(The format of our PDB-style files is described here.)

Timeline for d5dcxf_: