Lineage for d5d9ba_ (5d9b A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2075421Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2075505Family b.68.6.0: automated matches [277246] (1 protein)
    not a true family
  6. 2075506Protein automated matches [277247] (1 species)
    not a true protein
  7. 2075507Species Firefly (Photinus pyralis) [TaxId:7054] [277248] (10 PDB entries)
  8. 2075510Domain d5d9ba_: 5d9b A: [277251]
    automated match to d2ghsa1
    complexed with mg, mpd

Details for d5d9ba_

PDB Entry: 5d9b (more details), 1.5 Å

PDB Description: luciferin-regenerating enzyme solved by siras using xfel (refined against native data)
PDB Compounds: (A:) Luciferin regenerating enzyme

SCOPe Domain Sequences for d5d9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d9ba_ b.68.6.0 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi
iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw
tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv
deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe
vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf
agvkvkl

SCOPe Domain Coordinates for d5d9ba_:

Click to download the PDB-style file with coordinates for d5d9ba_.
(The format of our PDB-style files is described here.)

Timeline for d5d9ba_: