Lineage for d5d8xx_ (5d8x X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702789Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries)
  8. 2702837Domain d5d8xx_: 5d8x X: [277237]
    automated match to d4e6ka_
    complexed with hem, k, mpd, mrd, na

Details for d5d8xx_

PDB Entry: 5d8x (more details), 1.5 Å

PDB Description: 1.50a resolution structure of bfrb (l68a e81a) from pseudomonas aeruginosa
PDB Compounds: (X:) Ferroxidase

SCOPe Domain Sequences for d5d8xx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8xx_ a.25.1.1 (X:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8xx_:

Click to download the PDB-style file with coordinates for d5d8xx_.
(The format of our PDB-style files is described here.)

Timeline for d5d8xx_: