SCOPe 2.07: Domain d1cdga3: 1cdg A:407-495

Lineage for d1cdga3 (1cdg A:407-495)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1cdga3: 1cdg A:407-495 [27723]
   Other proteins in same PDB: d1cdga1, d1cdga2, d1cdga4
   complexed with ca, mal

Details for d1cdga3

PDB Entry: 1cdg, 2 Å

PDB Description: nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose- dependent crystal form

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cdga3:

Sequence; same for both SEQRES and ATOM records:

>d1cdga3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1cdga3:

• d1cdga3 first appeared (with stable ids) in SCOP 1.55, called d1cdg_3
  
• d1cdga3 appears in SCOPe 2.06
  
• d1cdga3 appears in the current release, SCOPe 2.08