Lineage for d1hvxa1 (1hvx A:394-483)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17311Protein Bacterial alpha-Amylase [51013] (4 species)
  7. 17320Species Bacillus stearothermophilus [TaxId:1422] [51017] (1 PDB entry)
  8. 17321Domain d1hvxa1: 1hvx A:394-483 [27721]
    Other proteins in same PDB: d1hvxa2

Details for d1hvxa1

PDB Entry: 1hvx (more details), 2 Å

PDB Description: bacillus stearothermophilus alpha-amylase
PDB Compounds: (A:)

SCOP Domain Sequences for d1hvxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvxa1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus stearothermophilus}
yaygtqhdyldhsdiigwtregvtekpgsglaalitdgpggskwmyvgkqhagkvfydlt
gnrsdtvtinsdgwgefkvnggsvsvwvpr

SCOP Domain Coordinates for d1hvxa1:

Click to download the PDB-style file with coordinates for d1hvxa1.
(The format of our PDB-style files is described here.)

Timeline for d1hvxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hvxa2