Lineage for d5d8pj_ (5d8p J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317862Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries)
  8. 2317996Domain d5d8pj_: 5d8p J: [277208]
    automated match to d3fvba_
    complexed with act, fe2, hem, k

Details for d5d8pj_

PDB Entry: 5d8p (more details), 2.35 Å

PDB Description: 2.35a resolution structure of iron bound bfrb (wild-type, c2221 form) from pseudomonas aeruginosa
PDB Compounds: (J:) Ferroxidase

SCOPe Domain Sequences for d5d8pj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8pj_ a.25.1.0 (J:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8pj_:

Click to download the PDB-style file with coordinates for d5d8pj_.
(The format of our PDB-style files is described here.)

Timeline for d5d8pj_: