Lineage for d5d8pf_ (5d8p F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729986Species Pseudomonas aeruginosa [TaxId:208964] [270448] (9 PDB entries)
  8. 1730112Domain d5d8pf_: 5d8p F: [277200]
    automated match to d3fvba_
    complexed with act, fe2, hem, k

Details for d5d8pf_

PDB Entry: 5d8p (more details), 2.35 Å

PDB Description: 2.35a resolution structure of iron bound bfrb (wild-type, c2221 form) from pseudomonas aeruginosa
PDB Compounds: (F:) Ferroxidase

SCOPe Domain Sequences for d5d8pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8pf_ a.25.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8pf_:

Click to download the PDB-style file with coordinates for d5d8pf_.
(The format of our PDB-style files is described here.)

Timeline for d5d8pf_: