Lineage for d1bag_1 (1bag 348-425)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17311Protein Bacterial alpha-Amylase [51013] (4 species)
  7. 17322Species Bacillus subtilis [TaxId:1423] [51016] (1 PDB entry)
  8. 17323Domain d1bag_1: 1bag 348-425 [27720]
    Other proteins in same PDB: d1bag_2

Details for d1bag_1

PDB Entry: 1bag (more details), 2.5 Å

PDB Description: alpha-amylase from bacillus subtilis complexed with maltopentaose
PDB Compounds: ( :)

SCOP Domain Sequences for d1bag_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bag_1 b.71.1.1 (348-425) Bacterial alpha-Amylase {Bacillus subtilis}
qpeelsnpngnnqifmnqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvnd
gkltgtinarsvavlypd

SCOP Domain Coordinates for d1bag_1:

Click to download the PDB-style file with coordinates for d1bag_1.
(The format of our PDB-style files is described here.)

Timeline for d1bag_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bag_2