SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5d8oe_ (5d8o E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (34 species)
    not a true protein
  7. 1990865Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (9 PDB entries)
  8. 1990882Domain d5d8oe_: 5d8o E: [277190]
    automated match to d3fvba_
    complexed with hem, k, pg4

Details for d5d8oe_

PDB Entry: 5d8o (more details), 1.9 Å

PDB Description: 1.90a resolution structure of bfrb (wild-type, c2221 form) from pseudomonas aeruginosa
PDB Compounds: (E:) Ferroxidase

SCOPe Domain Sequences for d5d8oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8oe_ a.25.1.0 (E:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8oe_:

Click to download the PDB-style file with coordinates for d5d8oe_.
(The format of our PDB-style files is described here.)

Timeline for d5d8oe_: