Lineage for d1aqh_1 (1aqh 355-448)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63034Protein Bacterial alpha-Amylase [51013] (4 species)
  7. 63035Species Alteromonas haloplanctis [51015] (3 PDB entries)
  8. 63037Domain d1aqh_1: 1aqh 355-448 [27718]
    Other proteins in same PDB: d1aqh_2

Details for d1aqh_1

PDB Entry: 1aqh (more details), 2 Å

PDB Description: alpha-amylase from alteromonas haloplanctis
PDB Compounds: ( :)

SCOP Domain Sequences for d1aqh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqh_1 b.71.1.1 (355-448) Bacterial alpha-Amylase {Alteromonas haloplanctis}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

SCOP Domain Coordinates for d1aqh_1:

Click to download the PDB-style file with coordinates for d1aqh_1.
(The format of our PDB-style files is described here.)

Timeline for d1aqh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqh_2