Lineage for d1aqh_1 (1aqh 355-448)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Bacterial alpha-Amylase [51013] (4 species) Species Alteromonas haloplanctis [51015] (3 PDB entries) 
Domain d1aqh_1: 1aqh 355-448 [27718]
Other proteins in same PDB: d1aqh_2
Details for d1aqh_1
PDB Entry: 1aqh (more details), 2 Å
PDB Description: alpha-amylase from alteromonas haloplanctis
SCOP Domain Sequences for d1aqh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqh_1 b.71.1.1 (355-448) Bacterial alpha-Amylase {Alteromonas haloplanctis}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln
SCOP Domain Coordinates for d1aqh_1:
Click to download the PDB-style file with coordinates for d1aqh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aqh_1:
- d1aqh_1 appears in SCOP 1.57
- d1aqh_1 appears in the current release, SCOPe 2.08, called d1aqha1
View in 3D
