Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189215] (12 PDB entries) |
Domain d5d8rc_: 5d8r C: [277173] automated match to d4e6ka_ complexed with hem, k |
PDB Entry: 5d8r (more details), 2.5 Å
SCOPe Domain Sequences for d5d8rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d8rc_ a.25.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie rilfleglpnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll kdileseeehidyletqlgliqkvglenylqshmhe
Timeline for d5d8rc_: