SCOPe 2.05: Domain d1aqma1: 1aqm A:355-448

Lineage for d1aqma1 (1aqm A:355-448)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Pseudoalteromonas haloplanktis [TaxId:228] [51015] (9 PDB entries)

8. Domain d1aqma1: 1aqm A:355-448 [27717]
   Other proteins in same PDB: d1aqma2
   complexed with ca, cl, trs

Details for d1aqma1

PDB Entry: 1aqm, 1.85 Å

PDB Description: alpha-amylase from alteromonas haloplanctis complexed with tris

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1aqma1:

Sequence; same for both SEQRES and ATOM records:

>d1aqma1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis [TaxId: 228]}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

Timeline for d1aqma1:

• d1aqma1 first appeared (with stable ids) in SCOP 1.55, called d1aqm_1
  
• d1aqma1 appears in SCOPe 2.04
  
• d1aqma1 appears in SCOPe 2.06
  
• d1aqma1 appears in the current release, SCOPe 2.08