Lineage for d1aqm_1 (1aqm 355-448)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) 
Protein Bacterial alpha-Amylase [51013] (4 species) 
Species Alteromonas haloplanctis [51015] (3 PDB entries) 
Domain d1aqm_1: 1aqm 355-448 [27717]
Other proteins in same PDB: d1aqm_2
Details for d1aqm_1
PDB Entry: 1aqm (more details), 1.85 Å
PDB Description: alpha-amylase from alteromonas haloplanctis complexed with tris
SCOP Domain Sequences for d1aqm_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqm_1 b.71.1.1 (355-448) Bacterial alpha-Amylase {Alteromonas haloplanctis}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln
SCOP Domain Coordinates for d1aqm_1:
Click to download the PDB-style file with coordinates for d1aqm_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aqm_1:
- d1aqm_1 first appeared (with stable ids) in SCOP 1.55
- d1aqm_1 appears in SCOP 1.59
- d1aqm_1 appears in the current release, SCOPe 2.08, called d1aqma1
View in 3D
