SCOPe 2.06: Domain d1bplb1: 1bpl B:394-482

Lineage for d1bplb1 (1bpl B:394-482)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries)

8. Domain d1bplb1: 1bpl B:394-482 [27716]
   Other proteins in same PDB: d1bpl.1

Details for d1bplb1

PDB Entry: 1bpl, 2.2 Å

PDB Description: glycosyltransferase

PDB Compounds: (B:) alpha-1,4-glucan-4-glucanohydrolase

SCOPe Domain Sequences for d1bplb1:

Sequence; same for both SEQRES and ATOM records:

>d1bplb1 b.71.1.1 (B:394-482) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvq

Timeline for d1bplb1:

• d1bplb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bplb1 appears in SCOPe 2.05
  
• d1bplb1 appears in SCOPe 2.07
  
• d1bplb1 appears in the current release, SCOPe 2.08