Class b: All beta proteins [48724] (141 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Bacterial alpha-Amylase [51013] (6 species) |
Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries) |
Domain d1bplb1: 1bpl B:394-482 [27716] Other proteins in same PDB: d1bpl.1 |
PDB Entry: 1bpl (more details), 2.2 Å
SCOP Domain Sequences for d1bplb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bplb1 b.71.1.1 (B:394-482) Bacterial alpha-Amylase {Bacillus licheniformis} yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit gnrsepvvinsegwgefhvnggsvsiyvq
Timeline for d1bplb1: