Lineage for d1bplb1 (1bpl B:394-482)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63034Protein Bacterial alpha-Amylase [51013] (4 species)
  7. 63039Species Bacillus licheniformis [TaxId:1402] [51014] (7 PDB entries)
  8. 63046Domain d1bplb1: 1bpl B:394-482 [27716]
    Other proteins in same PDB: d1bpl.1

Details for d1bplb1

PDB Entry: 1bpl (more details), 2.2 Å

PDB Description: glycosyltransferase

SCOP Domain Sequences for d1bplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bplb1 b.71.1.1 (B:394-482) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvq

SCOP Domain Coordinates for d1bplb1:

Click to download the PDB-style file with coordinates for d1bplb1.
(The format of our PDB-style files is described here.)

Timeline for d1bplb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpl.1
View in 3D
Domains from other chains:
(mouse over for more information)
d1bpl.1