Lineage for d1bli_1 (1bli 394-483)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380135Protein Bacterial alpha-Amylase [51013] (6 species)
  7. 380140Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries)
  8. 380145Domain d1bli_1: 1bli 394-483 [27715]
    Other proteins in same PDB: d1bli_2
    complexed with ca, na; mutant

Details for d1bli_1

PDB Entry: 1bli (more details), 1.9 Å

PDB Description: bacillus licheniformis alpha-amylase

SCOP Domain Sequences for d1bli_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bli_1 b.71.1.1 (394-483) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsagwgefhvnggsvsiyvqr

SCOP Domain Coordinates for d1bli_1:

Click to download the PDB-style file with coordinates for d1bli_1.
(The format of our PDB-style files is described here.)

Timeline for d1bli_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bli_2