SCOP 1.67: Domain d1bli_1: 1bli 394-483

Lineage for d1bli_1 (1bli 394-483)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (6 species)

7. Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries)

8. Domain d1bli_1: 1bli 394-483 [27715]
   Other proteins in same PDB: d1bli_2
   complexed with ca, na; mutant

Details for d1bli_1

PDB Entry: 1bli, 1.9 Å

PDB Description: bacillus licheniformis alpha-amylase

SCOP Domain Sequences for d1bli_1:

Sequence; same for both SEQRES and ATOM records:

>d1bli_1 b.71.1.1 (394-483) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsagwgefhvnggsvsiyvqr

Timeline for d1bli_1:

• d1bli_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bli_1 appears in SCOP 1.65
  
• d1bli_1 appears in SCOP 1.69
  
• d1bli_1 appears in the current release, SCOPe 2.08, called d1blia1