Lineage for d4d7da_ (4d7d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (28 PDB entries)
  8. 2005488Domain d4d7da_: 4d7d A: [277147]
    automated match to d1w0ea_
    complexed with hem, pkt

Details for d4d7da_

PDB Entry: 4d7d (more details), 2.76 Å

PDB Description: cytochrome p450 3a4 bound to an inhibitor
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d4d7da_:

Sequence, based on SEQRES records: (download)

>d4d7da_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkhr
vdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdvq
qklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfi
pkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfa
lmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

Sequence, based on observed residues (ATOM records): (download)

>d4d7da_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledthrvd
flqlmidsqnalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidav
lpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmips
yalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalir
vlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

SCOPe Domain Coordinates for d4d7da_:

Click to download the PDB-style file with coordinates for d4d7da_.
(The format of our PDB-style files is described here.)

Timeline for d4d7da_: