SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4d7da_ (4d7d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (35 PDB entries)
  8. 2005488Domain d4d7da_: 4d7d A: [277147]
    automated match to d1w0ea_
    complexed with hem, pkt

Details for d4d7da_

PDB Entry: 4d7d (more details), 2.76 Å

PDB Description: cytochrome p450 3a4 bound to an inhibitor
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d4d7da_:

Sequence, based on SEQRES records: (download)

>d4d7da_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkhr
vdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdvq
qklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfi
pkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfa
lmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

Sequence, based on observed residues (ATOM records): (download)

>d4d7da_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledthrvd
flqlmidsqnalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidav
lpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmips
yalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalir
vlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

SCOPe Domain Coordinates for d4d7da_:

Click to download the PDB-style file with coordinates for d4d7da_.
(The format of our PDB-style files is described here.)

Timeline for d4d7da_: