Lineage for d1vjs_1 (1vjs 394-482)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Bacterial alpha-Amylase [51013] (4 species) 
Species Bacillus licheniformis [TaxId:1402] [51014] (3 PDB entries) 
Domain d1vjs_1: 1vjs 394-482 [27714]
Other proteins in same PDB: d1vjs_2
Details for d1vjs_1
PDB Entry: 1vjs (more details), 1.7 Å
PDB Description: structure of alpha-amylase precursor
PDB Compounds: ( :) SCOP Domain Sequences for d1vjs_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjs_1 b.71.1.1 (394-482) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvq
SCOP Domain Coordinates for d1vjs_1:
Click to download the PDB-style file with coordinates for d1vjs_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vjs_1:
- d1vjs_1 appears in SCOP 1.57
- d1vjs_1 appears in the current release, SCOPe 2.07, called d1vjsa1
View in 3D
