Lineage for d1vjs_1 (1vjs 394-482)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17311Protein Bacterial alpha-Amylase [51013] (4 species)
  7. 17316Species Bacillus licheniformis [TaxId:1402] [51014] (3 PDB entries)
  8. 17318Domain d1vjs_1: 1vjs 394-482 [27714]
    Other proteins in same PDB: d1vjs_2

Details for d1vjs_1

PDB Entry: 1vjs (more details), 1.7 Å

PDB Description: structure of alpha-amylase precursor
PDB Compounds: ( :)

SCOP Domain Sequences for d1vjs_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjs_1 b.71.1.1 (394-482) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvq

SCOP Domain Coordinates for d1vjs_1:

Click to download the PDB-style file with coordinates for d1vjs_1.
(The format of our PDB-style files is described here.)

Timeline for d1vjs_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjs_2