SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5cx1d_ (5cx1 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143502Protein automated matches [190199] (3 species)
    not a true protein
  7. 2143503Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)
  8. 2143527Domain d5cx1d_: 5cx1 D: [277122]
    automated match to d1qh8b_
    complexed with ca, clf, hca, ics; mutant

Details for d5cx1d_

PDB Entry: 5cx1 (more details), 1.75 Å

PDB Description: nitrogenase molybdenum-iron protein beta-k400e mutant
PDB Compounds: (D:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d5cx1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cx1d_ c.92.2.3 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d5cx1d_:

Click to download the PDB-style file with coordinates for d5cx1d_.
(The format of our PDB-style files is described here.)

Timeline for d5cx1d_: