Lineage for d5cx1d_ (5cx1 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143502Protein automated matches [190199] (3 species)
    not a true protein
  7. 2143503Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)
  8. 2143527Domain d5cx1d_: 5cx1 D: [277122]
    automated match to d1qh8b_
    complexed with ca, clf, hca, ics; mutant

Details for d5cx1d_

PDB Entry: 5cx1 (more details), 1.75 Å

PDB Description: nitrogenase molybdenum-iron protein beta-k400e mutant
PDB Compounds: (D:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d5cx1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cx1d_ c.92.2.3 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d5cx1d_:

Click to download the PDB-style file with coordinates for d5cx1d_.
(The format of our PDB-style files is described here.)

Timeline for d5cx1d_: