Lineage for d1e2ra2 (1e2r A:136-567)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62941Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 62961Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 62962Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 62963Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
  7. 62964Species Paracoccus denitrificans [TaxId:266] [51009] (2 PDB entries)
  8. 62967Domain d1e2ra2: 1e2r A:136-567 [27712]
    Other proteins in same PDB: d1e2ra1, d1e2rb1

Details for d1e2ra2

PDB Entry: 1e2r (more details), 1.59 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound

SCOP Domain Sequences for d1e2ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2ra2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
efgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgstyeiktvldt
gyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwed
kyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivn
vketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegk
lvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsf
palgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaew
agitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptg
kfnvyntmtdty

SCOP Domain Coordinates for d1e2ra2:

Click to download the PDB-style file with coordinates for d1e2ra2.
(The format of our PDB-style files is described here.)

Timeline for d1e2ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e2ra1