![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
![]() | Domain d5cu5b4: 5cu5 B:638-960 [277114] Other proteins in same PDB: d5cu5a1, d5cu5a2, d5cu5a3, d5cu5a5, d5cu5b1, d5cu5b2, d5cu5b3, d5cu5b5 automated match to d3se6a4 complexed with nag |
PDB Entry: 5cu5 (more details), 3.02 Å
SCOPe Domain Sequences for d5cu5b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cu5b4 a.118.1.0 (B:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]} hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet itknikwleknlptlrtwlmvnt
Timeline for d5cu5b4: