| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Tyrosine-protein kinase SYK [118131] (1 species) PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries) Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576) |
| Domain d5cxha1: 5cxh A:363-635 [277113] Other proteins in same PDB: d5cxha2 automated match to d3tuca_ complexed with 55m |
PDB Entry: 5cxh (more details), 1.9 Å
SCOPe Domain Sequences for d5cxha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cxha1 d.144.1.7 (A:363-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvn
Timeline for d5cxha1: