Lineage for d1qksb2 (1qks B:136-567)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2809958Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 2809959Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 2809960Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species)
    the N-terminal domain is cytochrome c-like
  7. 2809961Species Paracoccus denitrificans [TaxId:266] [51009] (2 PDB entries)
  8. 2809963Domain d1qksb2: 1qks B:136-567 [27711]
    Other proteins in same PDB: d1qksa1, d1qksb1
    complexed with dhe, gol, hec, so4

Details for d1qksb2

PDB Entry: 1qks (more details), 1.28 Å

PDB Description: cytochrome cd1 nitrite reductase, oxidised form
PDB Compounds: (B:) cytochrome cd1 nitrite reductase

SCOPe Domain Sequences for d1qksb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qksb2 b.70.2.1 (B:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}
efgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvldt
gyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwed
kyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivn
vketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegk
lvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsf
palgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaew
agitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptg
kfnvyntmtdty

SCOPe Domain Coordinates for d1qksb2:

Click to download the PDB-style file with coordinates for d1qksb2.
(The format of our PDB-style files is described here.)

Timeline for d1qksb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qksb1