Lineage for d5cu5a3 (5cu5 A:547-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767032Domain d5cu5a3: 5cu5 A:547-637 [277108]
    Other proteins in same PDB: d5cu5a1, d5cu5a2, d5cu5a4, d5cu5a5, d5cu5b1, d5cu5b2, d5cu5b4, d5cu5b5
    automated match to d3se6a3
    complexed with nag

Details for d5cu5a3

PDB Entry: 5cu5 (more details), 3.02 Å

PDB Description: crystal structure of erap2 without catalytic zn(ii) atom
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5cu5a3:

Sequence, based on SEQRES records: (download)

>d5cu5a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

Sequence, based on observed residues (ATOM records): (download)

>d5cu5a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqerylwhipltystsssnvihrhilksktdtldlp
ektswvkfnvdsngyyivhyeg

SCOPe Domain Coordinates for d5cu5a3:

Click to download the PDB-style file with coordinates for d5cu5a3.
(The format of our PDB-style files is described here.)

Timeline for d5cu5a3: