Lineage for d5cu5a2 (5cu5 A:272-546)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530288Domain d5cu5a2: 5cu5 A:272-546 [277107]
    Other proteins in same PDB: d5cu5a1, d5cu5a3, d5cu5a4, d5cu5a5, d5cu5b1, d5cu5b3, d5cu5b4, d5cu5b5
    automated match to d3se6a2
    complexed with man, nag

Details for d5cu5a2

PDB Entry: 5cu5 (more details), 3.02 Å

PDB Description: crystal structure of erap2 without catalytic zn(ii) atom
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5cu5a2:

Sequence, based on SEQRES records: (download)

>d5cu5a2 d.92.1.0 (A:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg
gvchsdpkmtsnmlaflgenaevkemmttwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d5cu5a2 d.92.1.0 (A:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnslgenaevke
mmttwtlqkg

SCOPe Domain Coordinates for d5cu5a2:

Click to download the PDB-style file with coordinates for d5cu5a2.
(The format of our PDB-style files is described here.)

Timeline for d5cu5a2: