SCOPe 2.08: Domain d5cipl1: 5cip L:1-106

Lineage for d5cipl1 (5cip L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5cipl1: 5cip L:1-106 [277103]
   Other proteins in same PDB: d5cipb2, d5cipl2
   automated match to d2fjha1

Details for d5cipl1

PDB Entry: 5cip, 2.48 Å

PDB Description: crystal structure of unbound 4e10

PDB Compounds: (L:) fab 4e10 light chain

SCOPe Domain Sequences for d5cipl1:

Sequence; same for both SEQRES and ATOM records:

>d5cipl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d5cipl1:

• d5cipl1 first appeared in SCOPe 2.05
  
• d5cipl1 appears in SCOPe 2.07