SCOPe 2.05: Domain d5cipb1: 5cip B:1-106

Lineage for d5cipb1 (5cip B:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5cipb1: 5cip B:1-106 [277102]
   Other proteins in same PDB: d5cipb2, d5cipl2
   automated match to d2fjha1

Details for d5cipb1

PDB Entry: 5cip, 2.48 Å

PDB Description: crystal structure of unbound 4e10

PDB Compounds: (B:) fab 4e10 light chain

SCOPe Domain Sequences for d5cipb1:

Sequence; same for both SEQRES and ATOM records:

>d5cipb1 b.1.1.0 (B:1-106) automated matches {Homo sapiens [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d5cipb1:

• d5cipb1 is new in SCOPe 2.05-stable
  
• d5cipb1 appears in SCOPe 2.06
  
• d5cipb1 appears in the current release, SCOPe 2.08