Lineage for d1qksa2 (1qks A:136-567)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17239Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 17252Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 17253Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 17254Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
  7. 17255Species Paracoccus denitrificans [TaxId:266] [51009] (2 PDB entries)
  8. 17256Domain d1qksa2: 1qks A:136-567 [27710]
    Other proteins in same PDB: d1qksa1, d1qksb1

Details for d1qksa2

PDB Entry: 1qks (more details), 1.28 Å

PDB Description: cytochrome cd1 nitrite reductase, oxidised form

SCOP Domain Sequences for d1qksa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
efgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvldt
gyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwed
kyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivn
vketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegk
lvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsf
palgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaew
agitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptg
kfnvyntmtdty

SCOP Domain Coordinates for d1qksa2:

Click to download the PDB-style file with coordinates for d1qksa2.
(The format of our PDB-style files is described here.)

Timeline for d1qksa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qksa1