SCOPe 2.08: Domain d5bpya1: 5bpy A:396-657

Lineage for d5bpya1 (5bpy A:396-657)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5bpya1: 5bpy A:396-657 [277081]
   Other proteins in same PDB: d5bpya2, d5bpyb2
   automated match to d3pj2a_
   complexed with 4uq

Details for d5bpya1

PDB Entry: 5bpy, 2.31 Å

PDB Description: crystal structure of bruton agammaglobulinemia tyrosine kinase complexed with bms-824171 aka 6-[(3r)-3-(4-tert-bu tylbenzamido) piperidin-1-yl]-2-{[4-(morpholine-4-carbonyl) phenyl]amino}pyridine- 3-carboxamide

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5bpya1:

Sequence; same for both SEQRES and ATOM records:

>d5bpya1 d.144.1.7 (A:396-657) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameylesk
qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwh
ekaderptfkillsnildvmde

Timeline for d5bpya1:

• d5bpya1 first appeared in SCOPe 2.05, called d5bpya_
  
• d5bpya1 appears in SCOPe 2.07